PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g005330.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 713aa    MW: 78690 Da    PI: 5.3603
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g005330.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.33.4e-2059114156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe++F+++++p+ ++r++L k+lgL+  qVk+WFqN+R+++k
  Sopim10g005330.0.1  59 KKQYHRHTQHQIQELESFFKECPHPDDKQRKDLGKRLGLEPLQVKFWFQNKRTQMK 114
                         688999***********************************************998 PP

2START203.77.7e-642374581206
                         HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
               START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                         ela +a++el+++a+ +ep+W+         ++n++e+ ++f+++ +      ++ea+r+s+vv+ +   lve+l+d++ qW++ ++    
  Sopim10g005330.0.1 237 ELAVAAMEELIRLAQTDEPLWMNQNsdnndLILNEEEYARTFPRGIGpkslgLKSEASRESAVVIIDYLHLVEILMDVS-QWTNFFTgivs 326
                         57899******************9999988899***********999********************************.*********** PP

                         EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
               START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                         k ++lev+s+g      galq+m+ae+q++splvp R+ +fvRy++q+g+g+w++vdvS+++ ++ +    v R++++pSg++i++++ng+
  Sopim10g005330.0.1 327 KSTILEVLSTGvagnynGALQVMTAEFQVPSPLVPtRENYFVRYCKQHGDGTWAVVDVSLENLRSTS----VSRCRRRPSGCVIQELPNGY 413
                         ***************************************************************9965....8******************* PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         skvtw+ehv++++r + +++r+lv sgla+gak+wvatl+rqce+
  Sopim10g005330.0.1 414 SKVTWIEHVEVDDRAVNNIYRPLVDSGLAFGAKRWVATLERQCER 458
                         *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2142114IPR009057Homeodomain-like
SuperFamilySSF466899.19E-1944116IPR009057Homeodomain-like
PROSITE profilePS5007116.64956116IPR001356Homeobox domain
SMARTSM003893.6E-1858120IPR001356Homeobox domain
PfamPF000467.8E-1859114IPR001356Homeobox domain
CDDcd000867.76E-1859117No hitNo description
SuperFamilySSF559613.85E-38228460No hitNo description
PROSITE profilePS5084847.882228461IPR002913START domain
CDDcd088754.37E-123232457No hitNo description
SMARTSM002346.1E-62237458IPR002913START domain
PfamPF018525.1E-54238458IPR002913START domain
Gene3DG3DSA:3.30.530.202.3E-7295458IPR023393START-like domain
SuperFamilySSF559612.56E-24476704No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048825Biological Processcotyledon development
GO:0090627Biological Processplant epidermal cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 713 aa     Download sequence    Send to blast
MFQHNMFDSH NFLLDMTRKT PENELDLIRD DEFETKSGAD IMEGGASGDD QDPNKRPKKK  60
QYHRHTQHQI QELESFFKEC PHPDDKQRKD LGKRLGLEPL QVKFWFQNKR TQMKSQHERH  120
ENTQLRNEND KLRAENIRYK EALTTATCPN CGGPAAIGEM SFDEQHLRIE NARLREEIDR  180
ISGIAAKYVG KPMLNYPQLP SLGGNILGEM FTTTTSAGDL LRSISGPTDA DKPIVIELAV  240
AAMEELIRLA QTDEPLWMNQ NSDNNDLILN EEEYARTFPR GIGPKSLGLK SEASRESAVV  300
IIDYLHLVEI LMDVSQWTNF FTGIVSKSTI LEVLSTGVAG NYNGALQVMT AEFQVPSPLV  360
PTRENYFVRY CKQHGDGTWA VVDVSLENLR STSVSRCRRR PSGCVIQELP NGYSKVTWIE  420
HVEVDDRAVN NIYRPLVDSG LAFGAKRWVA TLERQCERLA SVMASNIPTG DVITSPEGRK  480
SMLKLAERMV MSFCAGVGAS TAHTWTTLSG SGADDVRVMT RKSIDDPGRP PGIVLSAATS  540
FWMPVPTKRV FDFLRDENSR NEWDILSNGG LVQEMAHIAN GRDSGNSVSL LRVNSGNSSQ  600
NNMLILQESC LDITGSYVIY APVDIAAMNV VLSGGDPDYV ALLPSGFAIL PDGSSNAENS  660
NIAGGSLLTV AFQILVDSVP TAKLSLGSVA TVNSLIKCTV ERIKASITCE NA*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248397.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
RefseqXP_010327238.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
RefseqXP_010327237.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLK4CX660.0K4CX66_SOLLC; Uncharacterized protein
STRINGSolyc10g005330.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein